PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_11912
Common NameKK1_012276
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Nin-like
Protein Properties Length: 932aa    MW: 103720 Da    PI: 6.5056
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_11912genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.23.8e-29621671252
         RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  C.cajan_11912 621 EKNVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 671
                    79***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.086603691IPR003035RWP-RK domain
PfamPF020422.4E-26623671IPR003035RWP-RK domain
SuperFamilySSF542778.5E-21827916No hitNo description
Gene3DG3DSA:3.10.20.2406.6E-22829911No hitNo description
PROSITE profilePS5174520.135832914IPR000270PB1 domain
SMARTSM006666.9E-20832914IPR000270PB1 domain
PfamPF005646.7E-16835913IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 932 aa     Download sequence    Send to blast
MEDHFPPKGK EIGYCTSPGV QLEESTSVDG GTKNSVSDDM FSYFSELMNF DTYAGWSNSP  60
SLTDQSLANV FSSFSSPPDG LNLVEHSNGP FFMTEVGEIH NDMESSPSCE ERVIFHQMDI  120
QLGFLDDANN LDSKQNHNGT SQKINTSDMC NYIISRSSGR SLNDRMLRAL SSFMESADAG  180
MLAQVWLPIK HGDEFILSTS EQPYLLDPKL AGYREVSRAF TFSAEGKPGS CPGLPARVFI  240
SHVPEWTSNV GYYNKTEYLR LEHAMNHEIR GSIALPISDE NSQVPCAVLE LVTTKEKPNF  300
DRELEIVTHA LQFLKKYVIY IQQSDQHRTN DKCPCDDFMQ LVNLRTTTPP RLLPQCLSSN  360
KRSALTEIID VLRAVCHAHR LPLALTWIPC CYREGTGDET ERIRIKEGRT SSNEKCVLCI  420
EESACYVNDG AVRGFVHACV EHHLVEGQGI AGKALQSNHP FFYTDVKTYD IVEYPLVHHA  480
RKYNLNAAVA IRLRSTYTND DDYILEFFLP VNMTGSSEQQ LLLDNLSGTM RRICRTLRTV  540
SDAELTGIEG SQGGFPREKV SGIFPLSRRN SQITFINDDH DSVQKMSLKV SNLKNNGIEA  600
AHSQEMNGSR KQIEKKRCTV EKNVSLSVLQ QYFSGSLKDA AKSIGVCPTT LKRICRQHGI  660
SRWPSRKINK VNRSLKKIQT VLDSVQGVEG GLKFDPYTGG FIAGGSIMQE TESHKYLLFP  720
EKSSVKDPKP ATQKKISVVS APGSTSENSA IKLDGNDVGL VGNHLVHSRS VLISSTNRVE  780
GADEHNHPTS SRTTDSSNGS GSIMHGSSSC SQSFENHKHS KVKSTCVDSG SKIIVKAGYR  840
GDTIRFKFDP SAGCFKLYEE VATRFKLQNG SFQLKYLDDE EEWVMLVNDS DLQECTEIMD  900
DIGTRCVKFL VRDVPCVLSS RDSNSCFLSD SS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2351720.0AC235172.1 Glycine max strain Williams 82 clone GM_WBb0002N17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539038.10.0PREDICTED: protein NLP9-like
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLA0A151TG330.0A0A151TG33_CAJCA; Uncharacterized protein
STRINGGLYMA11G13390.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein